PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g14497.1.p
Common NameBRADI_5g14497, LOC100843010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family bZIP
Protein Properties Length: 373aa    MW: 40127.6 Da    PI: 6.1912
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g14497.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1346.5e-11170227562
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                       kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L+ +l++l+     l+se
  Bradi5g14497.1.p 170 KRAKRILANRQSAARSKERKMRYIAELERKVQTLQTEATTLAAQLSMLQIDTTGLTSE 227
                       9*********************************************998777777666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.2E-17166230IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.427168231IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.3E-11170222No hitNo description
PfamPF001702.6E-9170222IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.87E-11170222No hitNo description
CDDcd147037.83E-22171218No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MDVPSASVST SAAAGSASRD VAAMPDTPPR RAARHRRAQS EILLGATALP DDLTFDADLG  60
VVGEGSGGGG DNYDDEDDYE EDEEGSGGGG GGSRMFEMFL ESGGGLAEPL EATPYPPPPP  120
SRPRHQHSMS MDGSTSLAAS SSAMAGRAGA DAKKAISDAK LAELSLVDPK RAKRILANRQ  180
SAARSKERKM RYIAELERKV QTLQTEATTL AAQLSMLQID TTGLTSENGD LKLRLQTIEQ  240
QVRMQDALND RLRDEVQQLK IATGQVNASS GKMGNFGLSS YGSNPQSYQR SHVQSLLAAQ  300
QLQQLQIHHS QQQQHQMQLQ DQQHLATVQR QRQQQLLQEA MPFRGDLKMK GIAMTSHVQN  360
AAAFDAHARS EP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580055.10.0PREDICTED: transcription factor RF2a-like
SwissprotQ040882e-84POF21_ARATH; Probable transcription factor PosF21
TrEMBLI1IZ860.0I1IZ86_BRADI; Uncharacterized protein
STRINGBRADI5G14497.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123022937
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.12e-44bZIP family protein